5-Letter Words Starting With C

There are 665 five-letter words that start with the letter C in the public-domain ENABLE dictionary — the word list most word games are built on. Know some letters already? The Wordle Solver narrows this list down using your greens, yellows, and grays.

Best Wordle guesses

Ranked by how many alternatives each word eliminates:

carescarsecastecatescestacanesceroscorescorsecirescriescausecadescasedcosiecapescrestcamesclosecoles

All 665 words

cabalcabbycabercabincablecabobcacaocacascachecacticaddycadescadetcadgecadgycadiscadrecaecacafescaffscagedcagercagescageycahowcaidscainscairdcairncajoncakedcakescakeycalfscalifcalixcalkscallacallscalmscalvecalyxcamascamelcameocamescampicampocampscampycanalcandycanedcanercanescanidcannacannycanoecanoncansocanstcantocantscantycapedcapercapescaphscaponcaposcaputcaratcarbocarbscardscaredcarercarescaretcarexcargocarkscarlecarlscarnscarnycarobcarolcaromcarpicarpscarrscarrycarsecartecartscarvecasascasedcasescaskscaskycastecastscasuscatchcatercatescattycauldcaulkcaulscausecavedcavercavescaviecavilcawedceasecebidcecalcecumcedarcededcedercedescedisceibaceilscelebcellacellicellocellscelomceltscensecentocentsceorlcepescerciceredceresceriacericceroscestacesticeteschadschafechaffchainchairchalkchampchamschangchantchaoschapechapschaptchardcharecharkcharmcharrcharschartcharychasechasmchatschawschayscheapcheatcheckcheekcheepcheerchefschelachemochertchesschestchethchevychewschewychiaochiaschickchicochicschidechiefchielchildchilechilichillchimbchimechimpchinachinechinkchinochinschipschirkchirmchirochirpchirrchitschivechivychockchoirchokechokycholochompchookchopschordchorechosechottchowschubschuckchufachuffchugschumpchumschunkchurlchurnchurrchutechylechymecibolcidercigarciliacimexcinchcinescionscircacirescirriciscocissycistscitedcitercitescivetcivicciviecivilcivvyclachclackcladecladsclagsclaimclampclamsclangclankclansclapsclaptclaroclaryclashclaspclassclastclaveclaviclawsclayscleanclearcleatcleekclefscleftclepecleptclerkclewsclickcliffcliftclimbclimeclineclingclinkclipscliptcloakclockclodsclogsclombclompcloneclonkclonsclootclopscloseclothclotscloudclourcloutcloveclowncloysclozeclubscluckcluedcluesclumpclungclunkcoachcoactcoalacoalscoalycoaptcoastcoaticoatscobbscobbycobiacoblecobracocascoccicockscockycocoacocoscodascodeccodedcodencodercodescodexcodoncoedscoffscogoncohogcohoscoifscoigncoilscoinscoirscokedcokescolascoldscoledcolescoliccolincollycologcoloncolorcoltscolzacomaecomalcomascombecombocombscomercomescometcomfycomiccomixcommacommycompocompscomptcomteconchcondoconedconesconeycongacongecongoconicconinconksconkyconnscontecontoconuscoochcooedcooeecooercooeycoofscookscookycoolscoolycoombcoonscoopscooptcootscopalcopedcopencopercopescopracopsecoralcorbycordscoredcorercorescorgicoriacorkscorkycormscornscornucornycorpscorsecoseccosescosetcoseycosiecostacostscotancotedcotescottacouchcoudecoughcouldcountcoupecoupscourtcouthcovedcovencovercovescovetcoveycovincowedcowercowlscowrycoxaecoxalcoxedcoxescoyedcoyercoylycoypucozencozescozeycoziecraalcrabscrackcraftcragscrakecrampcramscranecrankcrapecrapscrashcrasscratecravecrawlcrawscrazecrazycreakcreamcredocreedcreekcreelcreepcremecrepecreptcrepycresscrestcrewscribscrickcriedcriercriescrimecrimpcripecrispcroakcrocicrockcrocscroftcronecronycrookcrooncropscrorecrosscroupcrowdcrowncrowscrozecruckcrudecrudscruelcruetcrumbcrumpcruorcruracrusecrushcrustcrwthcryptcubbycubebcubedcubercubescubiccubitcuddycuffscuifscuingcuishcukesculchculetculexcullscullyculmsculpaculticultscumincuntscupelcupidcuppacuppycurbscurchcurdscurdycuredcurercurescuretcurfscuriacuriecuriocurlscurlycurnscurrscurrycursecurstcurvecurvycuseccushycuskscuspscussocutchcutercutescuteycutiecutincutiscuttycutupcyanocyanscycadcycascyclecyclocydercylixcymaecymarcymascymescymolcyniccystscytonczars

FAQ

How many 5-letter words start with C?

665 in the public-domain ENABLE dictionary (172,823 words total, 8,636 of them five letters long).

Are all of these valid Wordle guesses?

Almost all — Wordle's guess list is very close to ENABLE. A handful of obscure words may differ, but every common word here is accepted.

How are the top picks ranked?

By how common each word's distinct letters are across all 5-letter words, so a top pick eliminates the most alternatives — the same heuristic our Wordle Solver uses.

More lists