5-Letter Words Ending In K
There are 182 five-letter words that end in the letter K in the public-domain ENABLE dictionary — the word list most word games are built on. Know some letters already? The Wordle Solver narrows this list down using your greens, yellows, and grays.
Best Wordle guesses
Ranked by how many alternatives each word eliminates:
steaksneakspeaksamekstarksnarksmerkstalkslanksheiksparkstankcreaksharkstorktorskstirksneckslackbreak
All 182 words
abackacockalackamuckapeakapeekbatikbaulkblackblankbleakblinkblockbrankbreakbrickbrinkbriskbrockbrookbruskcaulkchalkcharkcheckcheekchickchinkchirkchockchookchuckchunkclackclankcleekclerkclickclinkcloakclockclonkcluckclunkcrackcrankcreakcreekcrickcroakcrockcrookcruckdrankdreckdrinkdroukdrunkflackflankflaskfleckflickflockflunkfrankfreakfriskfrockgleekgreekhacekhoickkaiakkamikkapokkayakkioskknackknockkopekkulakkyackmujikplackplankplinkplonkpluckplunkprankprickprinkpulikquackquarkquickquirkreinksameksculkshackshanksharksheikshirkshockshookshtikshuckskinkskulkskunkslackslanksleekslickslinkslunksmacksmeeksmerksmirksmocksnacksnarksneaksnecksnicksnooksnuckspanksparkspeakspeckspickspookspunkstackstalkstankstarksteaksteekstickstinkstirkstockstookstorkstuckstunkswankswinktaluktarokthackthankthickthinkthunktilaktorsktracktraiktranktricktroaktrocktrucktrunktupiktweakumiakwhackwhelkwhiskwrackwreakwreckwrickyapok
FAQ
How many 5-letter words end in K?
182 in the public-domain ENABLE dictionary (172,823 words total, 8,636 of them five letters long).
Are all of these valid Wordle guesses?
Almost all — Wordle's guess list is very close to ENABLE. A handful of obscure words may differ, but every common word here is accepted.
How are the top picks ranked?
By how common each word's distinct letters are across all 5-letter words, so a top pick eliminates the most alternatives — the same heuristic our Wordle Solver uses.